PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20975_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27425.4 Da    PI: 4.4522
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20975_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.3e-214295356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Neem_20975_f_2 42 KKRRLTPEQVHLLEKSFEAENKLEPERKAQLAKKLGLQPRQVAVWFQNRRARWK 95
                    5678*************************************************9 PP

2HD-ZIP_I/II124.93.7e-4041123183
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLeke 83 
                     ekkrrl+ eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy++Lk++ydal ++ e++   
  Neem_20975_f_2  41 EKKRRLTPEQVHLLEKSFEAENKLEPERKAQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKSSYDALLSNYEAVVVS 123
                     69************************************************************************999876543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-212499IPR009057Homeodomain-like
PROSITE profilePS5007117.9773797IPR001356Homeobox domain
SMARTSM003892.6E-2040101IPR001356Homeobox domain
PfamPF000462.4E-184295IPR001356Homeobox domain
CDDcd000861.91E-194298No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2343104IPR009057Homeodomain-like
PRINTSPR000311.6E-66877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000311.6E-67793IPR000047Helix-turn-helix motif
PfamPF021833.9E-1097120IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGKGARSMM NMEETSKRRL FFSSSPDDLF DDGYYDEQLP EKKRRLTPEQ VHLLEKSFEA  60
ENKLEPERKA QLAKKLGLQP RQVAVWFQNR RARWKTKQLE RDYDVLKSSY DALLSNYEAV  120
VVSLTEKLQA KEENKESKSS KKTEPLLEDI ANLCGLQFGN KIEDRLSSGS GGSAVVDEDG  180
PQLVVDSGDS YFGCMGPVDG IQSEEDDGSE DGRSYFSDVL VAAADHVDQQ HEEEALGWWV  240
WS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446470.11e-116hypothetical protein CICLE_v10017539mg
SwissprotQ022833e-86HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A067FFY41e-116A0A067FFY4_CITSI; Uncharacterized protein
TrEMBLV4U6L41e-116V4U6L4_9R
STRINGVIT_14s0066g01440.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88842738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-80homeobox 1